PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0082s00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family YABBY
Protein Properties Length: 194aa    MW: 21478.4 Da    PI: 5.5902
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0082s00180.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY157.79.8e-492516122166
             YABBY  22 lavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevp 110
                       + vsvP +sl++vvtvrCGhCtsllsvn++kas    +lla+ shl+ +   + ++       +   ++ +++sas  + s   + +e++ +p
  Vang0082s00180.1  25 YNVSVPCSSLSMVVTVRCGHCTSLLSVNMMKASfvpfHLLASLSHLEPKESSPEQD-------A--NKTLNSHSASLMTYS---DCEEEDLIP 105
                       579****************************9988888889988854332222222.......2..222333333333333...345556667 PP

             YABBY 111 rvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPki 166
                           v++PPekrqr Psayn+fikeei+r+ka+nPd++h+eafs+aaknWa fP+ 
  Vang0082s00180.1 106 MSNIVNKPPEKRQRTPSAYNCFIKEEIKRLKAENPDMAHKEAFSTAAKNWANFPPT 161
                       66779*************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046904.6E-5125162IPR006780YABBY protein
SuperFamilySSF470951.27E-9108161IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.8E-6111161IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MLECFPAMKT TLSTPFHKSL KYVTYNVSVP CSSLSMVVTV RCGHCTSLLS VNMMKASFVP  60
FHLLASLSHL EPKESSPEQD ANKTLNSHSA SLMTYSDCEE EDLIPMSNIV NKPPEKRQRT  120
PSAYNCFIKE EIKRLKAENP DMAHKEAFST AAKNWANFPP TQCKGDDQES CSQTDQLVDL  180
DSQVDPPDAE VKA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-68AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007157432.11e-119hypothetical protein PHAVU_002G069700g
SwissprotQ9LDT36e-51YAB4_ARATH; Axial regulator YABBY 4
TrEMBLV7CKI91e-119V7CKI9_PHAVU; Uncharacterized protein
STRINGGLYMA04G10125.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61442852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23420.14e-52YABBY family protein